Pay in 4 interest-free payments of $37.94 Learn more
Ships within 48 hours · Estimated delivery Jul 27 - Aug 1
Proteasome subunit p42
AA Sequence: RGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDL
using PRG4 antibody at 1:1000 dilution
BS62394-100
Uniprot: Q9HCD6
HDAC7 Polyclonal Antibody-BS90622 Magnetic Cell Purification Proteasome subunit p42HDAC7 Polyclonal Antibody Sizes: 50l, 100l Catalogue Numbers: BS90622 50, BS90622 100 Product: Rabbit IgG, 1mg ml in PBS with 0. 02% sodium azide, 50% glycerol, pH7. 2 Swiss Prot: Q8WUI4(Human) Q8C2B3(Mouse) Q99P96(Rat) Host: Rabbit Reactivity: Human, Mouse, Rat Applications: WB, FC All Applications: WB: 1: 1,000 1: 2,000 FC: 1: 50 1: 100 Background: In the intact cell, DNA closely associates with histones and other nuclear proteins to form chromatin.